PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A01G0024
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 264aa    MW: 28707.9 Da    PI: 6.3047
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A01G0024genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_123.99.3e-0888136351
                  XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                  e k  +r   NReA r++Rq+ ka+ + Le++v  L + N++L k+l+ 
  Gh_A01G0024  88 EKKPKKRSLGNREAVRKYRQKVKARAASLEDEVVRLRTLNQQLLKRLQG 136
                  668889999***********************************99974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.4E-1185154No hitNo description
SMARTSM003383.8E-686153IPR004827Basic-leucine zipper domain
CDDcd146862.19E-987145No hitNo description
PfamPF077164.6E-1288143IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.61E-690136No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MDEGELDFSN QEVFSGGNNM GDIPSSCSMD SFFNEILNDS HACTHTHTCN PPGPDNSHTH  60
TCFHVHTKIV PASTEDEAAA DDTEGSREKK PKKRSLGNRE AVRKYRQKVK ARAASLEDEV  120
VRLRTLNQQL LKRLQGQAAL EAEIARLKCL LVDVRGRIEG EIGSFPYQKP TANNVSTLNL  180
PGAYLMNPCN IQCNDQMYCL QPEVEGNTGE ATALDGHGFN GCEFDDIQCL ASQNSGAKEL  240
PRGGVGIAAS NGNSSGTKRR KGKI
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1098731170.0
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ3550300.0DQ355030.1 Gossypium hirsutum putative retinoblastoma binding protein gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012449574.10.0PREDICTED: uncharacterized protein LOC105772694 isoform X1
SwissprotQ8GTS21e-112BZP23_ARATH; Basic leucine zipper 23
TrEMBLA0A0D2NG610.0A0A0D2NG61_G
STRINGVIT_03s0038g02420.t011e-133(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20362879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.11e-110bZIP family protein